SCOPe 2.05: Domain d3fxja2: 3fxj A:297-368

Lineage for d3fxja2 (3fxj A:297-368)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
   topologically similar to the DNA/RNA-binding bundles; distinct packing

4. Superfamily a.159.1: Protein serine/threonine phosphatase 2C, C-terminal domain [81601] (2 families)
   automatically mapped to Pfam PF07830

5. Family a.159.1.0: automated matches [232204] (1 protein)
   not a true family

6. Protein automated matches [232205] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [232206] (8 PDB entries)

8. Domain d3fxja2: 3fxj A:297-368 [232207]
   Other proteins in same PDB: d3fxja1
   automated match to d1a6qa1
   complexed with mn, po4

Details for d3fxja2

PDB Entry: 3fxj, 2.5 Å

PDB Description: Crystal Structure of Human Protein phosphatase 1A (PPM1A) Bound with Phosphate at 3 mM of Mn2+

PDB Compounds: (A:) Protein phosphatase 1A

SCOPe Domain Sequences for d3fxja2:

Sequence, based on SEQRES records:

>d3fxja2 a.159.1.0 (A:297-368) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vspeavkkeaeldkylecrveeiikkqgegvpdlvhvmrtlasenipslppggelaskrn
vieavynrlnpy

Sequence, based on observed residues (ATOM records):

>d3fxja2 a.159.1.0 (A:297-368) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vspeavkkeaeldkylecrveeiikgvpdlvhvmrtlasenipslppggelaskrnviea
vynrlnpy

Timeline for d3fxja2:

• d3fxja2 first appeared in SCOPe 2.03
  
• d3fxja2 appears in SCOPe 2.04
  
• d3fxja2 appears in SCOPe 2.06
  
• d3fxja2 appears in the current release, SCOPe 2.08