SCOP 1.67: Domain d1czya1: 1czy A:350-501

Lineage for d1czya1 (1czy A:350-501)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (2 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.1: TRAF domain [49600] (3 proteins)

6. Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries)

8. Domain d1czya1: 1czy A:350-501 [23220]
   Other proteins in same PDB: d1czya2, d1czyb2, d1czyc2

Details for d1czya1

PDB Entry: 1czy, 2 Å

PDB Description: crystal structure of the complex between the traf domain of human traf2 and an lmp1 binding peptide

SCOP Domain Sequences for d1czya1:

Sequence; same for both SEQRES and ATOM records:

>d1czya1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens)}
ydgvfiwkisdfprkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

Timeline for d1czya1:

• d1czya1 first appeared (with stable ids) in SCOP 1.55
  
• d1czya1 appears in SCOP 1.65
  
• d1czya1 appears in SCOP 1.69
  
• d1czya1 appears in the current release, SCOPe 2.08