Lineage for d3fwwa1 (3fww A:4-251)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133197Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (4 protein domains)
  6. 2133247Protein automated matches [226998] (3 species)
    not a true protein
  7. 2133251Species Yersinia pestis [TaxId:386656] [232197] (1 PDB entry)
  8. 2133252Domain d3fwwa1: 3fww A:4-251 [232198]
    Other proteins in same PDB: d3fwwa2
    automated match to d1hv9a2

Details for d3fwwa1

PDB Entry: 3fww (more details), 2.5 Å

PDB Description: The crystal structure of the bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase from Yersinia pestis CO92
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d3fwwa1:

Sequence, based on SEQRES records: (download)

>d3fwwa1 c.68.1.5 (A:4-251) automated matches {Yersinia pestis [TaxId: 386656]}
ssmsvvilaagkgtrmysdlpkvlhplagkpmvqhvidaamklgaqhvhlvyghggellk
ktladpslnwvlqaeqlgtghamqqaaphfaddedilmlygdvplisvdtlqrllaakpe
ggiglltvkldnpsgygrivrengdvvgivehkdasdaqreineintgilvangrdlkrw
lslldnnnaqgefyitdiialahadgkkiatvhptrlsevegvnnrlqlsalervfqteq
aeklllag

Sequence, based on observed residues (ATOM records): (download)

>d3fwwa1 c.68.1.5 (A:4-251) automated matches {Yersinia pestis [TaxId: 386656]}
ssmsvvilaagkgtrmysdlpkvlhplagkpmvqhvidaamklgaqhvhlvyghggellk
ktladpslnwvlqaeqlgtghamqqaaphfaddedilmlygdvplisvdtlqrllaakpe
ggiglltvkldnpsgygrivrengdvvgivehkdasdaqreineintgilvangrdlkrw
lslldnnqgefyitdiialahadgkkiatvhptrlsevegvnnrlqlsalervfqteqae
klllag

SCOPe Domain Coordinates for d3fwwa1:

Click to download the PDB-style file with coordinates for d3fwwa1.
(The format of our PDB-style files is described here.)

Timeline for d3fwwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fwwa2