SCOPe 2.06: Domain d3fw2a1: 3fw2 A:214-360

Lineage for d3fw2a1 (3fw2 A:214-360)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:818] [232191] (2 PDB entries)

8. Domain d3fw2a1: 3fw2 A:214-360 [232192]
   Other proteins in same PDB: d3fw2a2, d3fw2b2, d3fw2c2, d3fw2d2
   automated match to d4nmua_
   complexed with act, edo

Details for d3fw2a1

PDB Entry: 3fw2, 1.74 Å

PDB Description: c-terminal domain of putative thiol-disulfide oxidoreductase from bacteroides thetaiotaomicron.

PDB Compounds: (A:) thiol-disulfide oxidoreductase

SCOPe Domain Sequences for d3fw2a1:

Sequence; same for both SEQRES and ATOM records:

>d3fw2a1 c.47.1.0 (A:214-360) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
kseigkyapffslpnakgekitrssdafkqksllinfwaswndsisqkqsnselreiykk
ykknkyigmlgisldvdkqqwkdaikrdtldweqvcdfgglnsevakqysiykipanill
ssdgkilaknlrgeelkkkieniveea

Timeline for d3fw2a1:

• d3fw2a1 first appeared in SCOPe 2.03, called d3fw2a_
  
• d3fw2a1 was called d3fw2a_ in SCOPe 2.05
  
• d3fw2a1 appears in SCOPe 2.07
  
• d3fw2a1 appears in the current release, SCOPe 2.08