Lineage for d3fuoa2 (3fuo A:1079-1295)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053846Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2053907Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 protein domains)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2053945Protein automated matches [229100] (4 species)
    not a true protein
  7. 2053946Species Clostridium botulinum [TaxId:1491] [229101] (9 PDB entries)
  8. 2053948Domain d3fuoa2: 3fuo A:1079-1295 [232190]
    Other proteins in same PDB: d3fuoa1
    automated match to d3btaa2

Details for d3fuoa2

PDB Entry: 3fuo (more details), 1.8 Å

PDB Description: The Crystal structure of receptor binding domain of botulinum neurotoxin serotype A
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d3fuoa2:

Sequence, based on SEQRES records: (download)

>d3fuoa2 b.42.4.2 (A:1079-1295) automated matches {Clostridium botulinum [TaxId: 1491]}
nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp
rgsvmttniylnsslyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq
agvekilsaleipdvgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnnia
klvasnwynrqierssrtlgcswefipvddgwgerpl

Sequence, based on observed residues (ATOM records): (download)

>d3fuoa2 b.42.4.2 (A:1079-1295) automated matches {Clostridium botulinum [TaxId: 1491]}
nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp
rgsvmttniylnsslyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq
agvekilsaleipdvgnlsqvvvmksknitnkckmnlqdnngndigfigfhqfnniaklv
asnwynrqiersslgcswefipvddgwgerpl

SCOPe Domain Coordinates for d3fuoa2:

Click to download the PDB-style file with coordinates for d3fuoa2.
(The format of our PDB-style files is described here.)

Timeline for d3fuoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fuoa1