Lineage for d3fuqa2 (3fuq A:1086-1278)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1791370Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 1791480Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 1791481Protein automated matches [190445] (5 species)
    not a true protein
  7. 1791487Species Clostridium botulinum [TaxId:1491] [225676] (21 PDB entries)
  8. 1791504Domain d3fuqa2: 3fuq A:1086-1278 [232189]
    Other proteins in same PDB: d3fuqa1
    automated match to d3btaa2

Details for d3fuqa2

PDB Entry: 3fuq (more details), 2.1 Å

PDB Description: Glycosylated SV2 and Gangliosides as Dual Receptors for Botulinum Neurotoxin Serotype F
PDB Compounds: (A:) BoNT/F (Neurotoxin type F)

SCOPe Domain Sequences for d3fuqa2:

Sequence, based on SEQRES records: (download)

>d3fuqa2 b.42.4.0 (A:1086-1278) automated matches {Clostridium botulinum [TaxId: 1491]}
dpsilkdfwgnyllynkryyllnllrtdksitqnsnflninqqrgvyqkpnifsntrlyt
gveviirkngstdisntdnfvrkndlayinvvdrdveyrlyadisiakpekiiklirtsn
snnslgqiivmdsignnctmnfqnnnggnigllgfhsnnlvasswyynnirkntssngcf
wsfiskehgwqen

Sequence, based on observed residues (ATOM records): (download)

>d3fuqa2 b.42.4.0 (A:1086-1278) automated matches {Clostridium botulinum [TaxId: 1491]}
dpsilkdfwgnyllynkryyllnllrtdksitqnsnflninqqrgvyqkpnifsntrlyt
gveviirknntdnfvrkndlayinvvdrdveyrlyadisiakpekiiklirtlgqiivmd
signnctmnfqnnnggnigllgfhsnnlvasswyynnirkntssngcfwsfiskehgwqe
n

SCOPe Domain Coordinates for d3fuqa2:

Click to download the PDB-style file with coordinates for d3fuqa2.
(The format of our PDB-style files is described here.)

Timeline for d3fuqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fuqa1