Lineage for d3fuoa1 (3fuo A:875-1078)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781196Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
    automatically mapped to Pfam PF07953
  6. 1781234Protein automated matches [229097] (3 species)
    not a true protein
  7. 1781235Species Clostridium botulinum [TaxId:1491] [229098] (3 PDB entries)
  8. 1781237Domain d3fuoa1: 3fuo A:875-1078 [232187]
    Other proteins in same PDB: d3fuoa2
    automated match to d3btaa1

Details for d3fuoa1

PDB Entry: 3fuo (more details), 1.8 Å

PDB Description: The Crystal structure of receptor binding domain of botulinum neurotoxin serotype A
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d3fuoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fuoa1 b.29.1.6 (A:875-1078) automated matches {Clostridium botulinum [TaxId: 1491]}
tsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknaivyn
smyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqeikq
rvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnnimf
kldgcrdthryiwikyfnlfdkel

SCOPe Domain Coordinates for d3fuoa1:

Click to download the PDB-style file with coordinates for d3fuoa1.
(The format of our PDB-style files is described here.)

Timeline for d3fuoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fuoa2