Lineage for d3fn8b2 (3fn8 B:81-209)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011496Fold d.357: NosL/MerB-like [160386] (1 superfamily)
    unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication
  4. 3011497Superfamily d.357.1: NosL/MerB-like [160387] (2 families) (S)
  5. 3011503Family d.357.1.2: MerB-like [160391] (1 protein)
    Pfam PF03243
  6. 3011504Protein Alkylmercury lyase MerB [160392] (1 species)
  7. 3011505Species Escherichia coli [TaxId:562] [160393] (17 PDB entries)
    Uniprot P77072 81-212
  8. 3011531Domain d3fn8b2: 3fn8 B:81-209 [232186]
    Other proteins in same PDB: d3fn8a1, d3fn8b1
    automated match to d3f0oa2
    complexed with gol, hg

Details for d3fn8b2

PDB Entry: 3fn8 (more details), 1.88 Å

PDB Description: crystal structure of merb complexed with mercury
PDB Compounds: (B:) Alkylmercury lyase

SCOPe Domain Sequences for d3fn8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fn8b2 d.357.1.2 (B:81-209) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
tsyvfeiddrrlyawcaldtlifpaligrtarvsshcaatgapvsltvspseiqavepag
mavslvlpqeaadvrqsfcchvhffasvptaedwaskhqgleglaivsvheafglgqefn
rhllqtmss

SCOPe Domain Coordinates for d3fn8b2:

Click to download the PDB-style file with coordinates for d3fn8b2.
(The format of our PDB-style files is described here.)

Timeline for d3fn8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fn8b1