SCOPe 2.03: Domain d3fmua_: 3fmu A:

Lineage for d3fmua_ (3fmu A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (8 species)
   not a true protein

7. Species Pleurotus eryngii [TaxId:5323] [226503] (14 PDB entries)

8. Domain d3fmua_: 3fmu A: [232182]
   automated match to d4fcna_
   complexed with ca, cac, fe, hem, zn

Details for d3fmua_

PDB Entry: 3fmu, 1.04 Å

PDB Description: crystal structure analysis of fungal versatile peroxidase from pleurotus eryngii

PDB Compounds: (A:) versatile peroxidase vpl2

SCOPe Domain Sequences for d3fmua_:

Sequence; same for both SEQRES and ATOM records:

>d3fmua_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]}
atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpepfdsvdsilarmgdagfspvevvsllashsiaaadkvdps
ipgtpfdstpgvfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
sdveqacaatpfpaltadp

Timeline for d3fmua_:

• d3fmua_ is new in SCOPe 2.03-stable
  
• d3fmua_ appears in SCOPe 2.04
  
• d3fmua_ appears in the current release, SCOPe 2.08