![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) ![]() automatically mapped to Pfam PF00016 |
![]() | Family c.1.14.0: automated matches [227297] (1 protein) not a true family |
![]() | Protein automated matches [227123] (6 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:226900] [232179] (1 PDB entry) |
![]() | Domain d3fk4a2: 3fk4 A:122-406 [232181] Other proteins in same PDB: d3fk4a1, d3fk4b1 automated match to d4nasa2 |
PDB Entry: 3fk4 (more details), 2 Å
SCOPe Domain Sequences for d3fk4a2:
Sequence, based on SEQRES records: (download)
>d3fk4a2 c.1.14.0 (A:122-406) automated matches {Bacillus cereus [TaxId: 226900]} pgpkfgidgirnllqvhdrpllmsifkgmigrnigylktqlrdqaiggvdivkddeilfe naltpltkrivsgkevlqsvyetyghktlyavnltgrtfdlkenakravqagadillfnv faygldvlqslaeddeipvpimahpavsgaysasklygvssplllgkllryagadfslfp spygsvalekeealaiskylteddasfkksfsvpsagihpgfvpfivrdfgkdvvinagg gihghpngaqgggkafrtaidatlqnkplhevddinlhsalqiwg
>d3fk4a2 c.1.14.0 (A:122-406) automated matches {Bacillus cereus [TaxId: 226900]} pgpkfgidgirnllqvhdrpllmsifkgmigrnigylktqlrdqaiggvdivkddeilfe naltpltkrivsgkevlqsvyetyghktlyavnltgrtfdlkenakravqagadillfnv faygldvlqslaeddeipvpimahpavsgaysasklygvssplllgkllryagadfslfp spykeealaiskylteddasfkksfsvpsagihpgfvpfivrdfgkdvvinagggihghp ngaqgggkafrtaidatlqnkplhevddinlhsalqiwg
Timeline for d3fk4a2: