Lineage for d1dcea2 (1dce A:242-350)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382505Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382966Superfamily b.7.4: Rab geranylgeranyltransferase alpha-subunit, insert domain [49594] (1 family) (S)
    automatically mapped to Pfam PF07711
  5. 2382967Family b.7.4.1: Rab geranylgeranyltransferase alpha-subunit, insert domain [49595] (1 protein)
  6. 2382968Protein Rab geranylgeranyltransferase alpha-subunit, insert domain [49596] (1 species)
  7. 2382969Species Norway rat (Rattus norvegicus) [TaxId:10116] [49597] (2 PDB entries)
  8. 2382970Domain d1dcea2: 1dce A:242-350 [23218]
    Other proteins in same PDB: d1dcea1, d1dcea3, d1dceb_, d1dcec1, d1dcec3, d1dced_
    complexed with zn

Details for d1dcea2

PDB Entry: 1dce (more details), 2 Å

PDB Description: crystal structure of rab geranylgeranyltransferase from rat brain
PDB Compounds: (A:) protein (rab geranylgeranyltransferase alpha subunit)

SCOPe Domain Sequences for d1dcea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dcea2 b.7.4.1 (A:242-350) Rab geranylgeranyltransferase alpha-subunit, insert domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hdvlccvhvsreeaclsvcfsrpltvgsrmgtlllmvdeaplsvewrtpdgrnrpshvwl
cdlpaaslndqlpqhtfrviwtgsdsqkecvllkdrpecwcrdsatdeq

SCOPe Domain Coordinates for d1dcea2:

Click to download the PDB-style file with coordinates for d1dcea2.
(The format of our PDB-style files is described here.)

Timeline for d1dcea2: