![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.4: Rab geranylgeranyltransferase alpha-subunit, insert domain [49594] (1 family) ![]() automatically mapped to Pfam PF07711 |
![]() | Family b.7.4.1: Rab geranylgeranyltransferase alpha-subunit, insert domain [49595] (1 protein) |
![]() | Protein Rab geranylgeranyltransferase alpha-subunit, insert domain [49596] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [49597] (2 PDB entries) |
![]() | Domain d1dcea2: 1dce A:242-350 [23218] Other proteins in same PDB: d1dcea1, d1dcea3, d1dceb_, d1dcec1, d1dcec3, d1dced_ complexed with zn |
PDB Entry: 1dce (more details), 2 Å
SCOPe Domain Sequences for d1dcea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dcea2 b.7.4.1 (A:242-350) Rab geranylgeranyltransferase alpha-subunit, insert domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} hdvlccvhvsreeaclsvcfsrpltvgsrmgtlllmvdeaplsvewrtpdgrnrpshvwl cdlpaaslndqlpqhtfrviwtgsdsqkecvllkdrpecwcrdsatdeq
Timeline for d1dcea2: