Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (33 species) not a true protein |
Species Bacteroides fragilis [TaxId:272559] [232176] (1 PDB entry) |
Domain d3fmbb1: 3fmb B:1-99 [232178] Other proteins in same PDB: d3fmba2, d3fmbb2 automated match to d3bgua_ complexed with edo, so4 |
PDB Entry: 3fmb (more details), 1.85 Å
SCOPe Domain Sequences for d3fmbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fmbb1 d.58.4.0 (B:1-99) automated matches {Bacteroides fragilis [TaxId: 272559]} mvkhivlfklrddvpveeklvvmnsfkeaiealpakisvirkievglnmnpgetwnialy sefdnlddvkfyathpehvaagkilaetkesracvdyef
Timeline for d3fmbb1: