SCOPe 2.08: Domain d3fmbb1: 3fmb B:1-99

Lineage for d3fmbb1 (3fmb B:1-99)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Bacteroides fragilis [TaxId:272559] [232176] (1 PDB entry)

8. Domain d3fmbb1: 3fmb B:1-99 [232178]
   Other proteins in same PDB: d3fmba2, d3fmbb2
   automated match to d3bgua_
   complexed with edo, so4

Details for d3fmbb1

PDB Entry: 3fmb, 1.85 Å

PDB Description: crystal structure of dimeric protein of unknown function and ferredoxin-like fold (yp_212648.1) from bacteroides fragilis nctc 9343 at 1.85 a resolution

PDB Compounds: (B:) Dimeric protein of unknown function and ferredoxin-like fold

SCOPe Domain Sequences for d3fmbb1:

Sequence; same for both SEQRES and ATOM records:

>d3fmbb1 d.58.4.0 (B:1-99) automated matches {Bacteroides fragilis [TaxId: 272559]}
mvkhivlfklrddvpveeklvvmnsfkeaiealpakisvirkievglnmnpgetwnialy
sefdnlddvkfyathpehvaagkilaetkesracvdyef

Timeline for d3fmbb1:

• d3fmbb1 first appeared in SCOPe 2.03, called d3fmbb_
  
• d3fmbb1 appears in SCOPe 2.07