SCOPe 2.06: Domain d3fmba1: 3fmb A:1-99

Lineage for d3fmba1 (3fmb A:1-99)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (27 species)
   not a true protein

7. Species Bacteroides fragilis [TaxId:272559] [232176] (1 PDB entry)

8. Domain d3fmba1: 3fmb A:1-99 [232177]
   Other proteins in same PDB: d3fmba2, d3fmbb2
   automated match to d3bgua_
   complexed with edo, so4

Details for d3fmba1

PDB Entry: 3fmb, 1.85 Å

PDB Description: crystal structure of dimeric protein of unknown function and ferredoxin-like fold (yp_212648.1) from bacteroides fragilis nctc 9343 at 1.85 a resolution

PDB Compounds: (A:) Dimeric protein of unknown function and ferredoxin-like fold

SCOPe Domain Sequences for d3fmba1:

Sequence; same for both SEQRES and ATOM records:

>d3fmba1 d.58.4.0 (A:1-99) automated matches {Bacteroides fragilis [TaxId: 272559]}
mvkhivlfklrddvpveeklvvmnsfkeaiealpakisvirkievglnmnpgetwnialy
sefdnlddvkfyathpehvaagkilaetkesracvdyef

Timeline for d3fmba1:

• d3fmba1 first appeared in SCOPe 2.03, called d3fmba_
  
• d3fmba1 was called d3fmba_ in SCOPe 2.05
  
• d3fmba1 appears in SCOPe 2.07
  
• d3fmba1 appears in the current release, SCOPe 2.08