Lineage for d3fm8a_ (3fm8 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778206Family b.26.1.0: automated matches [191616] (1 protein)
    not a true family
  6. 2778207Protein automated matches [191125] (8 species)
    not a true protein
  7. 2778225Species Human (Homo sapiens) [TaxId:9606] [189203] (4 PDB entries)
  8. 2778227Domain d3fm8a_: 3fm8 A: [232175]
    automated match to d1wlna1
    complexed with so4, unx, zn

Details for d3fm8a_

PDB Entry: 3fm8 (more details), 2.3 Å

PDB Description: crystal structure of full length centaurin alpha-1 bound with the fha domain of kif13b (capri target)
PDB Compounds: (A:) Kinesin-like protein KIF13B

SCOPe Domain Sequences for d3fm8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fm8a_ b.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cflvnlnadpalnellvyylkehtligsansqdiqlcgmgilpehciiditsegqvmltp
qkntrtfvngssvsspiqlhhgdrilwgnnhffrlnlp

SCOPe Domain Coordinates for d3fm8a_:

Click to download the PDB-style file with coordinates for d3fm8a_.
(The format of our PDB-style files is described here.)

Timeline for d3fm8a_: