| Class b: All beta proteins [48724] (180 folds) |
| Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) ![]() has a few short helices inserted in loops |
| Family b.26.1.0: automated matches [191616] (1 protein) not a true family |
| Protein automated matches [191125] (8 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189203] (4 PDB entries) |
| Domain d3fm8b_: 3fm8 B: [232174] automated match to d1wlna1 complexed with so4, unx, zn |
PDB Entry: 3fm8 (more details), 2.3 Å
SCOPe Domain Sequences for d3fm8b_:
Sequence, based on SEQRES records: (download)
>d3fm8b_ b.26.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cflvnlnadpalnellvyylkehtligsansqdiqlcgmgilpehciiditsegqvmltp
qkntrtfvngssvsspiqlhhgdrilwgnnhffrlnlp
>d3fm8b_ b.26.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cflvnlnadpalnellvyylkehtligsansqdiqlcgmgilpehciiditsvmltpqkn
trtfvngssvsspiqlhhgdrilwgnnhffrlnlp
Timeline for d3fm8b_: