SCOPe 2.08: Domain d3fm8b_: 3fm8 B:

Lineage for d3fm8b_ (3fm8 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.0: automated matches [191616] (1 protein)
   not a true family

6. Protein automated matches [191125] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189203] (4 PDB entries)

8. Domain d3fm8b_: 3fm8 B: [232174]
   automated match to d1wlna1
   complexed with so4, unx, zn

Details for d3fm8b_

PDB Entry: 3fm8, 2.3 Å

PDB Description: crystal structure of full length centaurin alpha-1 bound with the fha domain of kif13b (capri target)

PDB Compounds: (B:) Kinesin-like protein KIF13B

SCOPe Domain Sequences for d3fm8b_:

Sequence, based on SEQRES records:

>d3fm8b_ b.26.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cflvnlnadpalnellvyylkehtligsansqdiqlcgmgilpehciiditsegqvmltp
qkntrtfvngssvsspiqlhhgdrilwgnnhffrlnlp

Sequence, based on observed residues (ATOM records):

>d3fm8b_ b.26.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cflvnlnadpalnellvyylkehtligsansqdiqlcgmgilpehciiditsvmltpqkn
trtfvngssvsspiqlhhgdrilwgnnhffrlnlp

Timeline for d3fm8b_:

• d3fm8b_ first appeared in SCOPe 2.03
  
• d3fm8b_ appears in SCOPe 2.07