Lineage for d3fm4a_ (3fm4 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1275305Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1275306Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1275879Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 1275880Protein automated matches [191104] (8 species)
    not a true protein
  7. 1275918Species Pleurotus eryngii [TaxId:5323] [226503] (14 PDB entries)
  8. 1275930Domain d3fm4a_: 3fm4 A: [232172]
    automated match to d4fcna_
    complexed with ca, cac, fe, hem, zn

Details for d3fm4a_

PDB Entry: 3fm4 (more details), 2.11 Å

PDB Description: crystal structure analysis of fungal versatile peroxidase from pleurotus eryngii
PDB Compounds: (A:) versatile peroxidase vpl2

SCOPe Domain Sequences for d3fm4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fm4a_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]}
atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpepfdsvdsilarmgdagfspvevvwllashsiaaaakvdps
ipgtpfdstpgvfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
sdveqacaatpfpaltadp

SCOPe Domain Coordinates for d3fm4a_:

Click to download the PDB-style file with coordinates for d3fm4a_.
(The format of our PDB-style files is described here.)

Timeline for d3fm4a_: