![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) ![]() |
![]() | Family a.93.1.0: automated matches [191605] (1 protein) not a true family |
![]() | Protein automated matches [191104] (14 species) not a true protein |
![]() | Species Pleurotus eryngii [TaxId:5323] [226503] (19 PDB entries) |
![]() | Domain d3fm4a_: 3fm4 A: [232172] automated match to d4fcna_ complexed with ca, cac, fe, hem, zn |
PDB Entry: 3fm4 (more details), 2.11 Å
SCOPe Domain Sequences for d3fm4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fm4a_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]} atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri pfflgrpdavaaspdhlvpepfdsvdsilarmgdagfspvevvwllashsiaaaakvdps ipgtpfdstpgvfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl sdveqacaatpfpaltadp
Timeline for d3fm4a_: