Lineage for d1bmwa_ (1bmw A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792147Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 792336Superfamily b.7.3: PHL pollen allergen [49590] (1 family) (S)
  5. 792337Family b.7.3.1: PHL pollen allergen [49591] (2 proteins)
  6. 792342Protein PHL P 2 [49592] (1 species)
  7. 792343Species Timothy grass (Phleum pratense) [TaxId:15957] [49593] (3 PDB entries)
  8. 792346Domain d1bmwa_: 1bmw A: [23217]

Details for d1bmwa_

PDB Entry: 1bmw (more details)

PDB Description: a fibronectin type iii fold in plant allergens: the solution structure of phl pii from timothy grass pollen, nmr, 38 structures
PDB Compounds: (A:) pollen allergen phl p2

SCOP Domain Sequences for d1bmwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmwa_ b.7.3.1 (A:) PHL P 2 {Timothy grass (Phleum pratense) [TaxId: 15957]}
vpkvtftvekgsnekhlavlvkyegdtmaevelrehgsdewvamtkgeggvwtfdseepl
qgpfnfrfltekgmknvfddvvpekytigatyap

SCOP Domain Coordinates for d1bmwa_:

Click to download the PDB-style file with coordinates for d1bmwa_.
(The format of our PDB-style files is described here.)

Timeline for d1bmwa_: