SCOP 1.55: Domain d1bmw__: 1bmw -

Lineage for d1bmw__ (1bmw -)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.7: C2 domain-like [49561] (4 superfamilies)

4. Superfamily b.7.3: Pollen allergen PHL P 2 [49590] (1 family)

5. Family b.7.3.1: Pollen allergen PHL P 2 [49591] (1 protein)

6. Protein Pollen allergen PHL P 2 [49592] (1 species)

7. Species Timothy grass (Phleum pratense) [TaxId:15957] [49593] (3 PDB entries)

8. Domain d1bmw__: 1bmw - [23217]

Details for d1bmw__

PDB Entry: 1bmw

PDB Description: a fibronectin type iii fold in plant allergens: the solution structure of phl pii from timothy grass pollen, nmr, 38 structures

SCOP Domain Sequences for d1bmw__:

Sequence; same for both SEQRES and ATOM records:

>d1bmw__ b.7.3.1 (-) Pollen allergen PHL P 2 {Timothy grass (Phleum pratense)}
vpkvtftvekgsnekhlavlvkyegdtmaevelrehgsdewvamtkgeggvwtfdseepl
qgpfnfrfltekgmknvfddvvpekytigatyap

Timeline for d1bmw__:

• d1bmw__ appears in SCOP 1.57
  
• d1bmw__ appears in the current release, SCOPe 2.08, called d1bmwa_