Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (10 species) not a true protein |
Species Bacillus cereus [TaxId:226900] [232167] (1 PDB entry) |
Domain d3fk4a1: 3fk4 A:3-121 [232168] Other proteins in same PDB: d3fk4a2, d3fk4b2 automated match to d4nasa1 |
PDB Entry: 3fk4 (more details), 2 Å
SCOPe Domain Sequences for d3fk4a1:
Sequence, based on SEQRES records: (download)
>d3fk4a1 d.58.9.0 (A:3-121) automated matches {Bacillus cereus [TaxId: 226900]} giiatylihddshnlekkaeqialgltigswthlphllqeqlkqhkgnvihveelaeheh tnsylrkkvkrgiikieypllnfspdlpailtttfgklsldgevklidltfsdelkkhf
>d3fk4a1 d.58.9.0 (A:3-121) automated matches {Bacillus cereus [TaxId: 226900]} giiatylihddshnlekkaeqialgltigeqlkqhkgnvihveelaehehtnsylrkkvk rgiikieypllnfspdlpailtttfgklsldgevklidltfsdelkkhf
Timeline for d3fk4a1: