Lineage for d3fjwb_ (3fjw B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2003088Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2003089Protein automated matches [191104] (11 species)
    not a true protein
  7. 2003158Species Pleurotus eryngii [TaxId:5323] [226503] (19 PDB entries)
  8. 2003174Domain d3fjwb_: 3fjw B: [232166]
    automated match to d4fcna_
    complexed with ca, hem, man, mn, nag

Details for d3fjwb_

PDB Entry: 3fjw (more details), 2.8 Å

PDB Description: Crystal Structure Analysis of Fungal Versatile Peroxidase from Pleurotus eryngii
PDB Compounds: (B:) versatile peroxidase vpl2

SCOPe Domain Sequences for d3fjwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fjwb_ a.93.1.0 (B:) automated matches {Pleurotus eryngii [TaxId: 5323]}
atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpepfdsvdsilarmgdagfspvevvwllashsiaaadkvdps
ipgtpfdstpgvfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
sdveqacaatpfpaltadpgpvtsvppvpgs

SCOPe Domain Coordinates for d3fjwb_:

Click to download the PDB-style file with coordinates for d3fjwb_.
(The format of our PDB-style files is described here.)

Timeline for d3fjwb_: