Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (4 families) |
Family c.80.1.0: automated matches [191405] (1 protein) not a true family |
Protein automated matches [190547] (18 species) not a true protein |
Species Silicibacter pomeroyi [TaxId:246200] [225589] (1 PDB entry) |
Domain d3fj1c_: 3fj1 C: [232164] Other proteins in same PDB: d3fj1a2 automated match to d3fj1d_ complexed with cl, edo |
PDB Entry: 3fj1 (more details), 1.75 Å
SCOPe Domain Sequences for d3fj1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fj1c_ c.80.1.0 (C:) automated matches {Silicibacter pomeroyi [TaxId: 246200]} itrmrreideipeavqrlldhgaqdvarvaavlrlrdpsfvatvargssdhvctylsyaa elllglpvaslgpsvasvydarlrldralclavsqsgkspdivamtrnagrdgalcvalt ndaasplagvsahtidihagpelsvaatktfvtsavaglmlladwaeddglraalgnlpe tlaaasridwpemrvaigarpslftlgrgtslavsneaalkfketcqlhaesyssaevlh gpvsiveegfpvlgfaagdaaeaplaeiadqiaakgatvfattgrvtrarvlehvrsgha ltdplslivsfysmveafasergidpd
Timeline for d3fj1c_:
View in 3D Domains from other chains: (mouse over for more information) d3fj1a1, d3fj1a2, d3fj1b_, d3fj1d_ |