Lineage for d3fiaa_ (3fia A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2324762Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2324763Protein automated matches [190513] (36 species)
    not a true protein
  7. 2324820Species Human (Homo sapiens) [TaxId:9606] [189519] (56 PDB entries)
  8. 2324829Domain d3fiaa_: 3fia A: [232163]
    automated match to d1c07a_
    complexed with ca, so4

Details for d3fiaa_

PDB Entry: 3fia (more details), 1.45 Å

PDB Description: crystal structure of the eh 1 domain from human intersectin-1 protein. northeast structural genomics consortium target hr3646e.
PDB Compounds: (A:) Intersectin-1

SCOPe Domain Sequences for d3fiaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fiaa_ a.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpfggsldtwaitveerakhdqqfhslkpisgfitgdqarnfffqsglpqpvlaqiwala
dmnndgrmdqvefsiamkliklklqgyqlpsalppvmk

SCOPe Domain Coordinates for d3fiaa_:

Click to download the PDB-style file with coordinates for d3fiaa_.
(The format of our PDB-style files is described here.)

Timeline for d3fiaa_: