Lineage for d1whpa_ (1whp A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.7: C2 domain-like [49561] (5 superfamilies)
sandwich; 8 strands in 2 sheets; greek-key
Superfamily b.7.3: PHL pollen allergen [49590] (2 families) 
Family b.7.3.1: PHL pollen allergen [49591] (3 proteins)
automatically mapped to Pfam PF01357Protein PHL P 2 [49592] (1 species) Species Timothy grass (Phleum pratense) [TaxId:15957] [49593] (3 PDB entries) 
Domain d1whpa_: 1whp A: [23216]
Details for d1whpa_
PDB Entry: 1whp (more details), 3 Å
PDB Description: allergen phl p 2
PDB Compounds: (A:) allergen phl p 2SCOPe Domain Sequences for d1whpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whpa_ b.7.3.1 (A:) PHL P 2 {Timothy grass (Phleum pratense) [TaxId: 15957]}
vpkvtftvekgsnekhlavlvkyegdtmaevelrehgsdewvamtkgeggvwtfdseepl
qgpfnfrfltekgmknvfddvvpekytigatyap
SCOPe Domain Coordinates for d1whpa_:
Click to download the PDB-style file with coordinates for d1whpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1whpa_:
- d1whpa_ first appeared (with stable ids) in SCOP 1.55, called d1whp__
- d1whpa_ appears in SCOPe 2.07
View in 3D