| Class b: All beta proteins [48724] (180 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.3: PHL pollen allergen [49590] (2 families) ![]() |
| Family b.7.3.1: PHL pollen allergen [49591] (3 proteins) automatically mapped to Pfam PF01357 |
| Protein PHL P 2 [49592] (1 species) |
| Species Timothy grass (Phleum pratense) [TaxId:15957] [49593] (3 PDB entries) |
| Domain d1whpa_: 1whp A: [23216] |
PDB Entry: 1whp (more details), 3 Å
SCOPe Domain Sequences for d1whpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whpa_ b.7.3.1 (A:) PHL P 2 {Timothy grass (Phleum pratense) [TaxId: 15957]}
vpkvtftvekgsnekhlavlvkyegdtmaevelrehgsdewvamtkgeggvwtfdseepl
qgpfnfrfltekgmknvfddvvpekytigatyap
Timeline for d1whpa_: