SCOPe 2.05: Domain d3fdwb_: 3fdw B:

Lineage for d3fdwb_ (3fdw B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.0: automated matches [191388] (1 protein)
   not a true family

6. Protein automated matches [190497] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188711] (19 PDB entries)

8. Domain d3fdwb_: 3fdw B: [232159]
   automated match to d1v27a_

Details for d3fdwb_

PDB Entry: 3fdw, 2.2 Å

PDB Description: crystal structure of a c2 domain from human synaptotagmin-like protein 4

PDB Compounds: (B:) Synaptotagmin-like protein 4

SCOPe Domain Sequences for d3fdwb_:

Sequence; same for both SEQRES and ATOM records:

>d3fdwb_ b.7.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifvtgriafslkyeqqtqslvvhvkechqlayadeakkrsnpyvktyllpdksrqgkrkt
sikrdtvnplydetlryeipesllaqrtlqfsvwhhgrfgrntflgeaeiqmdswkldkk
ldhclplhgk

Timeline for d3fdwb_:

• d3fdwb_ first appeared in SCOPe 2.03
  
• d3fdwb_ appears in SCOPe 2.04
  
• d3fdwb_ appears in SCOPe 2.06
  
• d3fdwb_ appears in the current release, SCOPe 2.08