Lineage for d3fcra_ (3fcr A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1614338Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1614339Protein automated matches [190151] (83 species)
    not a true protein
  7. 1614806Species Silicibacter sp. [TaxId:292414] [232155] (1 PDB entry)
  8. 1614807Domain d3fcra_: 3fcr A: [232156]
    automated match to d3gjua_
    complexed with edo, plp

Details for d3fcra_

PDB Entry: 3fcr (more details), 1.8 Å

PDB Description: crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. tm1040 at 1.80 a resolution
PDB Compounds: (A:) Putative aminotransferase

SCOPe Domain Sequences for d3fcra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fcra_ c.67.1.0 (A:) automated matches {Silicibacter sp. [TaxId: 292414]}
gmlkndqldqwdrdnffhpsthlaqhargesanrviktasgvfiedrdgtklldafagly
cvnvgygrqeiaeaiadqarelayyhsyvghgteasitlakmildrapknmskvyfglgg
sdanetnvkliwyynnilgrpekkkiisrwrgyhgsglvtgsltglelfhkkfdlpveqv
ihteapyyfrredlnqteeqfvahcvaelealieregadtiaafigepilgtggivpppa
gyweaiqtvlnkhdillvadevvtgfgrlgtmfgsdhyglepdiitiakgltsayaplsg
sivsdkvwkvleqgtdengpighgwtysahpigaaagvanlklldelnlvsnagevgayl
natmaealsqhanvgdvrgegllcavefvkdrdsrtffdaadkigpqisaklleqdkiia
rampqgdilgfappfcltraeadqvvegtlravkavlg

SCOPe Domain Coordinates for d3fcra_:

Click to download the PDB-style file with coordinates for d3fcra_.
(The format of our PDB-style files is described here.)

Timeline for d3fcra_: