Lineage for d3fb3a_ (3fb3 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969505Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [232152] (2 PDB entries)
  8. 2969508Domain d3fb3a_: 3fb3 A: [232153]
    Other proteins in same PDB: d3fb3b2
    automated match to d2fe7b_

Details for d3fb3a_

PDB Entry: 3fb3 (more details), 2.35 Å

PDB Description: crystal structure of trypanosoma brucei acetyltransferase, tb11.01.2886
PDB Compounds: (A:) n-acetyltransferase

SCOPe Domain Sequences for d3fb3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fb3a_ d.108.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
dlelrvleesdlsshlellghlteapplsgvelaniadmrrragivtkvfchqptgrivg
saslmiqpkftrggravghiedvvvdpsyrgaglgkalimdlceisrskgcykvildsse
kslpfyeklgfraherqmrldl

SCOPe Domain Coordinates for d3fb3a_:

Click to download the PDB-style file with coordinates for d3fb3a_.
(The format of our PDB-style files is described here.)

Timeline for d3fb3a_: