SCOPe 2.06: Domain d3f92a1: 3f92 A:-1-156

Lineage for d3f92a1 (3f92 A:-1-156)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species)
   ubc1 homologue; also contains the C-terminal UBA domain

7. Species Human (Homo sapiens) [TaxId:9606] [143064] (7 PDB entries)
   Uniprot P61086 1-156

8. Domain d3f92a1: 3f92 A:-1-156 [232149]
   Other proteins in same PDB: d3f92a2
   automated match to d3e46a2
   complexed with bme, ca, pg4, trs; mutant

Details for d3f92a1

PDB Entry: 3f92, 2.23 Å

PDB Description: crystal structure of ubiquitin-conjugating enzyme e2-25kda (huntington interacting protein 2) m172a mutant crystallized at ph 8.5

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 K, chimera with Azorectase

SCOPe Domain Sequences for d3f92a1:

Sequence; same for both SEQRES and ATOM records:

>d3f92a1 d.20.1.1 (A:-1-156) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Human (Homo sapiens) [TaxId: 9606]}
fdmaniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryql
eikipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqalla
aaepddpqdavvanqykqnpemfkqtarlwahvyagap

Timeline for d3f92a1:

• d3f92a1 first appeared in SCOPe 2.03
  
• d3f92a1 appears in SCOPe 2.05
  
• d3f92a1 appears in SCOPe 2.07
  
• d3f92a1 appears in the current release, SCOPe 2.08