Lineage for d3f92a1 (3f92 A:1-156)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2507730Family d.20.1.1: UBC-related [54496] (7 protein domains)
  6. 2507938Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species)
    ubc1 homologue; also contains the C-terminal UBA domain
  7. 2507941Species Human (Homo sapiens) [TaxId:9606] [143064] (7 PDB entries)
    Uniprot P61086 1-156
  8. 2507949Domain d3f92a1: 3f92 A:1-156 [232149]
    Other proteins in same PDB: d3f92a2, d3f92a3
    automated match to d3e46a2
    complexed with bme, ca, pg4, trs; mutant

Details for d3f92a1

PDB Entry: 3f92 (more details), 2.23 Å

PDB Description: crystal structure of ubiquitin-conjugating enzyme e2-25kda (huntington interacting protein 2) m172a mutant crystallized at ph 8.5
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 K

SCOPe Domain Sequences for d3f92a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f92a1 d.20.1.1 (A:1-156) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Human (Homo sapiens) [TaxId: 9606]}
maniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqlei
kipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaa
epddpqdavvanqykqnpemfkqtarlwahvyagap

SCOPe Domain Coordinates for d3f92a1:

Click to download the PDB-style file with coordinates for d3f92a1.
(The format of our PDB-style files is described here.)

Timeline for d3f92a1: