SCOPe 2.05: Domain d3f6qa_: 3f6q A:

Lineage for d3f6qa_ (3f6q A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.0: automated matches [191667] (1 protein)
   not a true family

6. Protein automated matches [191267] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189837] (18 PDB entries)

8. Domain d3f6qa_: 3f6q A: [232148]
   automated match to d4hi9a_
   complexed with iod, po4, zn

Details for d3f6qa_

PDB Entry: 3f6q, 1.6 Å

PDB Description: Crystal structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1 LIM1 domain

PDB Compounds: (A:) Integrin-linked protein kinase

SCOPe Domain Sequences for d3f6qa_:

Sequence; same for both SEQRES and ATOM records:

>d3f6qa_ d.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddiftqcregnavavrlwldntendlnqgddhgfsplhwacregrsavvemlimrgarin
vmnrgddtplhlaashghrdivqkllqykadinavnehgnvplhyacfwgqdqvaedlva
ngalvsicnkygempvdkakaplrellreraekmgqnlnripykdtfwk

Timeline for d3f6qa_:

• d3f6qa_ first appeared in SCOPe 2.03
  
• d3f6qa_ appears in SCOPe 2.04
  
• d3f6qa_ appears in SCOPe 2.06
  
• d3f6qa_ appears in the current release, SCOPe 2.08