SCOPe 2.08: Domain d3f5xd2: 3f5x D:310-432

Lineage for d3f5xd2 (3f5x D:310-432)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
   Uniprot P20248 175-432

8. Domain d3f5xd2: 3f5x D:310-432 [232146]
   Other proteins in same PDB: d3f5xa_, d3f5xc_
   automated match to d1oiub2
   complexed with ezv, gol, so4

Details for d3f5xd2

PDB Entry: 3f5x, 2.4 Å

PDB Description: CDK-2-Cyclin complex with indazole inhibitor 9 bound at its active site

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d3f5xd2:

Sequence; same for both SEQRES and ATOM records:

>d3f5xd2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d3f5xd2:

• d3f5xd2 first appeared in SCOPe 2.03
  
• d3f5xd2 appears in SCOPe 2.07