Lineage for d3f5xb1 (3f5x B:177-309)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273869Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1273870Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1273871Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1273884Protein Cyclin A [47956] (2 species)
  7. 1273920Species Human (Homo sapiens) [TaxId:9606] [47957] (73 PDB entries)
    Uniprot P20248 175-432
  8. 1274147Domain d3f5xb1: 3f5x B:177-309 [232145]
    Other proteins in same PDB: d3f5xa_, d3f5xc_
    automated match to d1finb1
    complexed with ezv, gol, so4

Details for d3f5xb1

PDB Entry: 3f5x (more details), 2.4 Å

PDB Description: CDK-2-Cyclin complex with indazole inhibitor 9 bound at its active site
PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d3f5xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f5xb1 a.74.1.1 (B:177-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
dyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlav
nyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmeh
lvlkvltfdlaap

SCOPe Domain Coordinates for d3f5xb1:

Click to download the PDB-style file with coordinates for d3f5xb1.
(The format of our PDB-style files is described here.)

Timeline for d3f5xb1: