Lineage for d1bf8_2 (1bf8 122-205)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11282Fold b.7: C2 domain-like [49561] (4 superfamilies)
  4. 11348Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) (S)
  5. 11349Family b.7.2.1: Periplasmic chaperone C-domain [49585] (2 proteins)
  6. 11350Protein FimC [49588] (1 species)
  7. 11351Species Escherichia coli [TaxId:562] [49589] (2 PDB entries)
  8. 11360Domain d1bf8_2: 1bf8 122-205 [23214]
    Other proteins in same PDB: d1bf8_1

Details for d1bf8_2

PDB Entry: 1bf8 (more details)

PDB Description: periplasmic chaperone fimc, nmr, 20 structures

SCOP Domain Sequences for d1bf8_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bf8_2 b.7.2.1 (122-205) FimC {Escherichia coli}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

SCOP Domain Coordinates for d1bf8_2:

Click to download the PDB-style file with coordinates for d1bf8_2.
(The format of our PDB-style files is described here.)

Timeline for d1bf8_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bf8_1