Lineage for d3f2gb2 (3f2g B:81-208)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617286Fold d.357: NosL/MerB-like [160386] (1 superfamily)
    unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication
  4. 2617287Superfamily d.357.1: NosL/MerB-like [160387] (2 families) (S)
  5. 2617293Family d.357.1.2: MerB-like [160391] (1 protein)
    Pfam PF03243
  6. 2617294Protein Alkylmercury lyase MerB [160392] (1 species)
  7. 2617295Species Escherichia coli [TaxId:562] [160393] (17 PDB entries)
    Uniprot P77072 81-212
  8. 2617301Domain d3f2gb2: 3f2g B:81-208 [232139]
    Other proteins in same PDB: d3f2ga1, d3f2gb1
    automated match to d3f0oa2
    mutant

Details for d3f2gb2

PDB Entry: 3f2g (more details), 1.78 Å

PDB Description: crystal structure of merb mutant c160s, the organomercurial lyase involved in a bacterial mercury resistance system
PDB Compounds: (B:) Alkylmercury lyase

SCOPe Domain Sequences for d3f2gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f2gb2 d.357.1.2 (B:81-208) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
tsyvfeiddrrlyawcaldtlifpaligrtarvsshcaatgapvsltvspseiqavepag
mavslvlpqeaadvrqsfcshvhffasvptaedwaskhqgleglaivsvheafglgqefn
rhllqtms

SCOPe Domain Coordinates for d3f2gb2:

Click to download the PDB-style file with coordinates for d3f2gb2.
(The format of our PDB-style files is described here.)

Timeline for d3f2gb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f2gb1