Lineage for d3f2gb1 (3f2g B:1-80)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694465Family a.4.5.79: MerB N-terminal domain-like [158323] (1 protein)
  6. 2694466Protein Alkylmercury lyase MerB [158324] (1 species)
  7. 2694467Species Escherichia coli [TaxId:562] [158325] (17 PDB entries)
    Uniprot P77072 21-80
  8. 2694473Domain d3f2gb1: 3f2g B:1-80 [232138]
    Other proteins in same PDB: d3f2ga2, d3f2gb2
    automated match to d3f0oa1
    mutant

Details for d3f2gb1

PDB Entry: 3f2g (more details), 1.78 Å

PDB Description: crystal structure of merb mutant c160s, the organomercurial lyase involved in a bacterial mercury resistance system
PDB Compounds: (B:) Alkylmercury lyase

SCOPe Domain Sequences for d3f2gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f2gb1 a.4.5.79 (B:1-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
mklapyilelltsvnrtngtadllvpllrelakgrpvsrttlagildwpaervaavleqa
tsteydkdgniigygltlre

SCOPe Domain Coordinates for d3f2gb1:

Click to download the PDB-style file with coordinates for d3f2gb1.
(The format of our PDB-style files is described here.)

Timeline for d3f2gb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f2gb2