SCOPe 2.08: Domain d3f1wa2: 3f1w A:127-254

Lineage for d3f1wa2 (3f1w A:127-254)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (8 PDB entries)
   Uniprot P15873

8. Domain d3f1wa2: 3f1w A:127-254 [232135]
   automated match to d1plqa2
   mutant

Details for d3f1wa2

PDB Entry: 3f1w, 2.9 Å

PDB Description: crystal structure of a mutant proliferating cell nuclear antigen that blocks translesion synthesis

PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d3f1wa2:

Sequence; same for both SEQRES and ATOM records:

>d3f1wa2 d.131.1.2 (A:127-254) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsssviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkf

Timeline for d3f1wa2:

• d3f1wa2 first appeared in SCOPe 2.03
  
• d3f1wa2 appears in SCOPe 2.07