Lineage for d3ewob_ (3ewo B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120592Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2120593Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2120748Family c.50.1.0: automated matches [191326] (1 protein)
    not a true family
  6. 2120749Protein automated matches [190146] (11 species)
    not a true protein
  7. 2120753Species Avian infectious bronchitis virus [TaxId:11120] [232123] (2 PDB entries)
  8. 2120755Domain d3ewob_: 3ewo B: [232125]
    Other proteins in same PDB: d3ewoa2
    automated match to d3ekea_

Details for d3ewob_

PDB Entry: 3ewo (more details), 1.8 Å

PDB Description: IBV Nsp3 ADRP domain
PDB Compounds: (B:) non-structural protein 3

SCOPe Domain Sequences for d3ewob_:

Sequence, based on SEQRES records: (download)

>d3ewob_ c.50.1.0 (B:) automated matches {Avian infectious bronchitis virus [TaxId: 11120]}
kpkfleyktcvgdlavviakaldefkefcivnaanehmshgggvakaiadfcgpdfveyc
adyvkkhgpqqklvtpsfvkgiqcvnnvvgprhgdsnlreklvaayksvlvggvvnyvvp
vlssgifgvdfkisidamreafkgcairvllfslsqehidyfdatc

Sequence, based on observed residues (ATOM records): (download)

>d3ewob_ c.50.1.0 (B:) automated matches {Avian infectious bronchitis virus [TaxId: 11120]}
kpkfleyktcvgdlavviakaldefkefcivnaanehmshgggvakaiadfcgpdfveyc
adyvkkhgpqqklvtpsfvkgiqcvnnvvgprhgdsnlreklvaayksvlvggvvnyvvp
vlssgigvdfkisidamreafkgcairvllfslsqehidyfdatc

SCOPe Domain Coordinates for d3ewob_:

Click to download the PDB-style file with coordinates for d3ewob_.
(The format of our PDB-style files is described here.)

Timeline for d3ewob_: