Lineage for d3ewoa_ (3ewo A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.50: Macro domain-like [52948] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the restSuperfamily c.50.1: Macro domain-like [52949] (3 families) 
Family c.50.1.0: automated matches [191326] (1 protein)
not a true familyProtein automated matches [190146] (9 species)
not a true protein
Species Avian infectious bronchitis virus [TaxId:11120] [232123] (2 PDB entries) 
Domain d3ewoa_: 3ewo A: [232124]
automated match to d3ekea_
Details for d3ewoa_
PDB Entry: 3ewo (more details), 1.8 Å
PDB Description: IBV Nsp3 ADRP domain
PDB Compounds: (A:) non-structural protein 3SCOPe Domain Sequences for d3ewoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ewoa_ c.50.1.0 (A:) automated matches {Avian infectious bronchitis virus [TaxId: 11120]}
lgsvkpatcekpkfleyktcvgdlavviakaldefkefcivnaanehmshgggvakaiad
fcgpdfveycadyvkkhgpqqklvtpsfvkgiqcvnnvvgprhgdsnlreklvaayksvl
vggvvnyvvpvlssgifgvdfkisidamreafkgcairvllfslsqehidyfdatck
SCOPe Domain Coordinates for d3ewoa_:
Click to download the PDB-style file with coordinates for d3ewoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ewoa_:
- d3ewoa_ first appeared in SCOPe 2.03
- d3ewoa_ appears in SCOPe 2.04
- d3ewoa_ is called d3ewoa1 in SCOPe 2.06
- d3ewoa_ appears in the current release, SCOPe 2.08, called d3ewoa1
View in 3D
