Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (51 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [193863] (7 PDB entries) |
Domain d3ewia_: 3ewi A: [232121] automated match to d4hgnb_ |
PDB Entry: 3ewi (more details), 1.9 Å
SCOPe Domain Sequences for d3ewia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ewia_ c.108.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} keikllvcnidgcltnghiyvsgdqkeiisydvkdaigisllkksgievrliseracskq tlsalkldcktevsvsdklatvdewrkemglcwkevaylgnevsdeeclkrvglsavpad acsgaqkavgyickcsggrgairefaehiflliekvn
Timeline for d3ewia_: