Lineage for d3ewia_ (3ewi A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166914Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2166915Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2167647Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2167648Protein automated matches [190447] (51 species)
    not a true protein
  7. 2167926Species Mouse (Mus musculus) [TaxId:10090] [193863] (7 PDB entries)
  8. 2167927Domain d3ewia_: 3ewi A: [232121]
    automated match to d4hgnb_

Details for d3ewia_

PDB Entry: 3ewi (more details), 1.9 Å

PDB Description: structural analysis of the c-terminal domain of murine cmp-sialic acid synthetase
PDB Compounds: (A:) N-acylneuraminate cytidylyltransferase

SCOPe Domain Sequences for d3ewia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ewia_ c.108.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
keikllvcnidgcltnghiyvsgdqkeiisydvkdaigisllkksgievrliseracskq
tlsalkldcktevsvsdklatvdewrkemglcwkevaylgnevsdeeclkrvglsavpad
acsgaqkavgyickcsggrgairefaehiflliekvn

SCOPe Domain Coordinates for d3ewia_:

Click to download the PDB-style file with coordinates for d3ewia_.
(The format of our PDB-style files is described here.)

Timeline for d3ewia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ewib_