SCOPe 2.07: Domain d3egwa2: 3egw A:1075-1244

Lineage for d3egwa2 (3egw A:1075-1244)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.0: automated matches [191648] (1 protein)
   not a true family

6. Protein automated matches [191195] (10 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [232115] (4 PDB entries)

8. Domain d3egwa2: 3egw A:1075-1244 [232119]
   Other proteins in same PDB: d3egwa1, d3egwb_, d3egwc_
   automated match to d1q16a1
   complexed with 3ph, 6mo, aga, f3s, hem, md1, mgd, sf4; mutant

Details for d3egwa2

PDB Entry: 3egw, 1.9 Å

PDB Description: the crystal structure of the narghi mutant narh - c16a

PDB Compounds: (A:) Respiratory nitrate reductase 1 alpha chain

SCOPe Domain Sequences for d3egwa2:

Sequence; same for both SEQRES and ATOM records:

>d3egwa2 b.52.2.0 (A:1075-1244) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw
ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp
thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqes

Timeline for d3egwa2:

• d3egwa2 first appeared in SCOPe 2.03
  
• d3egwa2 appears in SCOPe 2.06
  
• d3egwa2 appears in the current release, SCOPe 2.08