SCOPe 2.07: Domain d3etrl2: 3etr L:93-165

Lineage for d3etrl2 (3etr L:93-165)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families)
   contains 2Fe-2S cluster

5. Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)

6. Protein automated matches [232101] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232106] (10 PDB entries)

8. Domain d3etrl2: 3etr L:93-165 [232117]
   Other proteins in same PDB: d3etra1, d3etrb1, d3etrb2, d3etrc1, d3etrc2, d3etrl1, d3etrm1, d3etrm2, d3etrn1, d3etrn2
   automated match to d1v97a1
   complexed with ca, fad, fes, luz, mos, mte

Details for d3etrl2

PDB Entry: 3etr, 2.2 Å

PDB Description: crystal structure of xanthine oxidase in complex with lumazine

PDB Compounds: (L:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3etrl2:

Sequence; same for both SEQRES and ATOM records:

>d3etrl2 a.56.1.1 (L:93-165) automated matches {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

Timeline for d3etrl2:

• d3etrl2 first appeared in SCOPe 2.03
  
• d3etrl2 appears in SCOPe 2.06
  
• d3etrl2 appears in the current release, SCOPe 2.08