Lineage for d1qunk2 (1qun K:122-205)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304037Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1304224Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 1304225Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 1304243Protein FimC [49588] (1 species)
  7. 1304244Species Escherichia coli [TaxId:562] [49589] (8 PDB entries)
  8. 1304264Domain d1qunk2: 1qun K:122-205 [23211]
    Other proteins in same PDB: d1quna1, d1qunb1, d1qunb2, d1qunc1, d1qund1, d1qund2, d1qune1, d1qunf1, d1qunf2, d1qung1, d1qunh1, d1qunh2, d1quni1, d1qunj1, d1qunj2, d1qunk1, d1qunl1, d1qunl2, d1qunm1, d1qunn1, d1qunn2, d1quno1, d1qunp1, d1qunp2

Details for d1qunk2

PDB Entry: 1qun (more details), 2.8 Å

PDB Description: x-ray structure of the fimc-fimh chaperone adhesin complex from uropathogenic e.coli
PDB Compounds: (K:) papd-like chaperone fimc

SCOPe Domain Sequences for d1qunk2:

Sequence, based on SEQRES records: (download)

>d1qunk2 b.7.2.1 (K:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklpsda
gsnityrtindygaltpkmtgvme

Sequence, based on observed residues (ATOM records): (download)

>d1qunk2 b.7.2.1 (K:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklsnit
yrtindygaltpkmtgvme

SCOPe Domain Coordinates for d1qunk2:

Click to download the PDB-style file with coordinates for d1qunk2.
(The format of our PDB-style files is described here.)

Timeline for d1qunk2: