| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) ![]() automatically mapped to Pfam PF03450 |
| Family d.87.2.0: automated matches [232089] (1 protein) not a true family |
| Protein automated matches [232090] (2 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [232091] (10 PDB entries) |
| Domain d3etrb2: 3etr B:415-528 [232100] Other proteins in same PDB: d3etra1, d3etra2, d3etrb1, d3etrc1, d3etrc2, d3etrl1, d3etrl2, d3etrm1, d3etrn1, d3etrn2 automated match to d1v97a4 complexed with ca, fad, fes, luz, mos, mte |
PDB Entry: 3etr (more details), 2.2 Å
SCOPe Domain Sequences for d3etrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3etrb2 d.87.2.0 (B:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg
Timeline for d3etrb2: