Lineage for d3eh8a2 (3eh8 A:126-254)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1919359Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 1919370Superfamily d.95.2: Homing endonucleases [55608] (3 families) (S)
  5. 1919371Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
    contains two extra helices in the C-terminal extension
  6. 1919427Protein automated matches [190411] (4 species)
    not a true protein
  7. 1919433Species Emericella nidulans [TaxId:162425] [232056] (1 PDB entry)
  8. 1919435Domain d3eh8a2: 3eh8 A:126-254 [232099]
    automated match to d1p8kz2
    protein/DNA complex; protein/RNA complex; complexed with ca

Details for d3eh8a2

PDB Entry: 3eh8 (more details), 2.7 Å

PDB Description: crystal structure of y2 i-anii variant (f13y/s111y)/dna complex with calcium
PDB Compounds: (A:) Intron-encoded DNA endonuclease I-AniI

SCOPe Domain Sequences for d3eh8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eh8a2 d.95.2.1 (A:126-254) automated matches {Emericella nidulans [TaxId: 162425]}
nsiesiintsyfsawlvgfieaegcfsvyklnkdddyliasfdiaqrdgdilisairkyl
sfttkvyldktncsklkvtsvrsveniikflqnapvkllgnkklqyklwlkqlrkisrys
ekikipsny

SCOPe Domain Coordinates for d3eh8a2:

Click to download the PDB-style file with coordinates for d3eh8a2.
(The format of our PDB-style files is described here.)

Timeline for d3eh8a2: