![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) ![]() |
![]() | Family d.129.1.0: automated matches [227265] (1 protein) not a true family |
![]() | Protein automated matches [227057] (4 species) not a true protein |
![]() | Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [232060] (3 PDB entries) |
![]() | Domain d3eikb2: 3eik B:114-198 [232094] automated match to d1ytba2 complexed with edo |
PDB Entry: 3eik (more details), 1.9 Å
SCOPe Domain Sequences for d3eikb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eikb2 d.129.1.0 (B:114-198) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} kiqnivsscdikfsirleglayahsnycsyepelfpgliyrmvkpkivllifvsgkivlt gakvrddiyqafnniypvliqhrka
Timeline for d3eikb2: