Lineage for d1qung2 (1qun G:122-205)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163036Fold b.7: C2 domain-like [49561] (4 superfamilies)
  4. 163106Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) (S)
  5. 163107Family b.7.2.1: Periplasmic chaperone C-domain [49585] (3 proteins)
  6. 163108Protein FimC [49588] (1 species)
  7. 163109Species Escherichia coli [TaxId:562] [49589] (4 PDB entries)
  8. 163121Domain d1qung2: 1qun G:122-205 [23209]
    Other proteins in same PDB: d1quna1, d1qunb1, d1qunb2, d1qunc1, d1qund1, d1qund2, d1qune1, d1qunf1, d1qunf2, d1qung1, d1qunh1, d1qunh2, d1quni1, d1qunj1, d1qunj2, d1qunk1, d1qunl1, d1qunl2, d1qunm1, d1qunn1, d1qunn2, d1quno1, d1qunp1, d1qunp2

Details for d1qung2

PDB Entry: 1qun (more details), 2.8 Å

PDB Description: x-ray structure of the fimc-fimh chaperone adhesin complex from uropathogenic e.coli
PDB Compounds: (G:)

SCOP Domain Sequences for d1qung2:

Sequence, based on SEQRES records: (download)

>d1qung2 b.7.2.1 (G:122-205) FimC {Escherichia coli}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklpsda
gsnityrtindygaltpkmtgvme

Sequence, based on observed residues (ATOM records): (download)

>d1qung2 b.7.2.1 (G:122-205) FimC {Escherichia coli}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklsnit
yrtindygaltpkmtgvme

SCOP Domain Coordinates for d1qung2:

Click to download the PDB-style file with coordinates for d1qung2.
(The format of our PDB-style files is described here.)

Timeline for d1qung2: