SCOPe 2.07: Domain d3eika2: 3eik A:114-197

Lineage for d3eika2 (3eik A:114-197)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.0: automated matches [227265] (1 protein)
   not a true family

6. Protein automated matches [227057] (4 species)
   not a true protein

7. Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [232060] (3 PDB entries)

8. Domain d3eika2: 3eik A:114-197 [232087]
   automated match to d1ytba2
   complexed with edo

Details for d3eika2

PDB Entry: 3eik, 1.9 Å

PDB Description: double stranded DNA binding protein

PDB Compounds: (A:) tata-box-binding protein

SCOPe Domain Sequences for d3eika2:

Sequence; same for both SEQRES and ATOM records:

>d3eika2 d.129.1.0 (A:114-197) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
kiqnivsscdikfsirleglayahsnycsyepelfpgliyrmvkpkivllifvsgkivlt
gakvrddiyqafnniypvliqhrk

Timeline for d3eika2:

• d3eika2 first appeared in SCOPe 2.03
  
• d3eika2 appears in SCOPe 2.06
  
• d3eika2 appears in the current release, SCOPe 2.08