Lineage for d3eika2 (3eik A:114-197)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431002Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1431003Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 1431182Family d.129.1.0: automated matches [227265] (1 protein)
    not a true family
  6. 1431183Protein automated matches [227057] (3 species)
    not a true protein
  7. 1431193Species Encephalitozoon cuniculi [TaxId:6035] [232060] (2 PDB entries)
  8. 1431199Domain d3eika2: 3eik A:114-197 [232087]
    automated match to d1ytba2
    complexed with edo

Details for d3eika2

PDB Entry: 3eik (more details), 1.9 Å

PDB Description: double stranded DNA binding protein
PDB Compounds: (A:) tata-box-binding protein

SCOPe Domain Sequences for d3eika2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eika2 d.129.1.0 (A:114-197) automated matches {Encephalitozoon cuniculi [TaxId: 6035]}
kiqnivsscdikfsirleglayahsnycsyepelfpgliyrmvkpkivllifvsgkivlt
gakvrddiyqafnniypvliqhrk

SCOPe Domain Coordinates for d3eika2:

Click to download the PDB-style file with coordinates for d3eika2.
(The format of our PDB-style files is described here.)

Timeline for d3eika2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3eika1