Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) |
Family d.129.1.0: automated matches [227265] (1 protein) not a true family |
Protein automated matches [227057] (3 species) not a true protein |
Species Encephalitozoon cuniculi [TaxId:6035] [232060] (2 PDB entries) |
Domain d3eika2: 3eik A:114-197 [232087] automated match to d1ytba2 complexed with edo |
PDB Entry: 3eik (more details), 1.9 Å
SCOPe Domain Sequences for d3eika2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eika2 d.129.1.0 (A:114-197) automated matches {Encephalitozoon cuniculi [TaxId: 6035]} kiqnivsscdikfsirleglayahsnycsyepelfpgliyrmvkpkivllifvsgkivlt gakvrddiyqafnniypvliqhrk
Timeline for d3eika2: