| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
| Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins) automatically mapped to Pfam PF00941 |
| Protein automated matches [232070] (1 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [232074] (10 PDB entries) |
| Domain d3etrb1: 3etr B:224-414 [232084] Other proteins in same PDB: d3etra1, d3etra2, d3etrb2, d3etrc1, d3etrc2, d3etrl1, d3etrl2, d3etrm2, d3etrn1, d3etrn2 automated match to d3b9jb2 complexed with ca, fad, fes, luz, mos, mte |
PDB Entry: 3etr (more details), 2.2 Å
SCOPe Domain Sequences for d3etrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3etrb1 d.145.1.3 (B:224-414) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre
Timeline for d3etrb1: